PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G343200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 410aa    MW: 46320.6 Da    PI: 6.7161
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G343200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-16113158147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Aqcoe3G343200.2.p 113 RGHWRPAEDTKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 158
                        899*****************************.***********996 PP

2Myb_DNA-binding54.52.6e-17165208146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        r+++ +eE+e+l  a++++G++ W+ Iar ++ gRt++++k++w+ 
  Aqcoe3G343200.2.p 165 RKAFNEEEEERLMAAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 208
                        7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.201108159IPR017930Myb domain
SMARTSM007173.3E-14112161IPR001005SANT/Myb domain
PfamPF002496.9E-16113158IPR001005SANT/Myb domain
SuperFamilySSF466893.29E-27113206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-25114166IPR009057Homeodomain-like
CDDcd001675.67E-13116157No hitNo description
PROSITE profilePS5129425.693160214IPR017930Myb domain
SMARTSM007173.9E-14164212IPR001005SANT/Myb domain
PfamPF002497.1E-14165207IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-20167213IPR009057Homeodomain-like
CDDcd001676.36E-11167207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MKMTLQQSNT TNFHQKNEDM GSLSINSNRK SCWSSFPFIG NNTTNSCLDD AQNSEGGDGK  60
CSDFSDGFEE NNAAMEDNNT NNNVMNFNEE NPNENCANGK EIDSSGQSKL CARGHWRPAE  120
DTKLKELVAL YGPQNWNLIA EKLEGRSGKS CRLRWFNQLD PRINRKAFNE EEEERLMAAH  180
RLYGNKWAMI ARLFPGRTDN SVKNHWHVIM ARKYREQSSA YRRRKLSQAV HRRMDENGRS  240
SEPNNPNLSN NGSFNSTSTF PFGGYIGGVS NDSVSSCRDK LVVASSNIHS HSHRLPQHIH  300
NGFCAEETPF DFFSGPKNQD MTSYFNQNRS WDRQGDDSTY NGFYTHHPPL MVAMQQANQQ  360
HYPIYFSDSK TSTSHVSVNE ASSSSIEETN HFETTISPPF IDFLGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-311132137107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257780.11e-171PREDICTED: uncharacterized protein LOC104597747
TrEMBLF6HPQ31e-149F6HPQ3_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g02600.t011e-149(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.17e-76myb domain protein 105